PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 742aa    MW: 83283.6 Da    PI: 6.1945
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038995.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.53.4e-1153687391374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++ A+av+++d++ a++lL+++++++sp gd +qRla++f+++L+arla+++s++yk l +++ts    ++ l+a++l+  +sP+ k+s+++ 
  Pbr038995.1 368 LRTLLISWAQAVAADDHRTANELLKKVRQHSSPFGDGTQRLAHCFANGLEARLAGTGSKIYKGLVSKRTS---AADILKAYHLYLAASPFKKMSNFVS 462
                  5789************************************************************999999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N +I++ +e+++r+H+iDf+i +G+QWp+L+q ++ R++gpp++RiTg++ p++g   +e++eetg+rLa +Ae+++vpfe+n+ +ak++e+++leeL
  Pbr038995.1 463 NVTIMNLAEKSTRLHVIDFGILYGFQWPTLIQRISWREGGPPKVRITGIEFPQPGfrPAERVEETGRRLAAYAEKFNVPFEYNA-IAKKWETITLEEL 559
                  ******************************************************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E+l+Vn+ ++ ++lldesvs++s r++vL+l+++++P+++++   +  +n++ F++rf eal ++s+lfd+le+ +pre++er+ +E+e++gr
  Pbr038995.1 560 KIDKDEVLVVNFLYRGKNLLDESVSVDSVRNRVLDLIRRINPDIFIHGVVNGAYNAPFFVTRFREALFHFSSLFDMLETVVPREDQERMLIEKEIFGR 657
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  e+ nv+aceg er+er et+++W+ r  +aGF ++p++ + +k a   ++  + + + ++e+s +l++gWk+r+ +++SaW+
  Pbr038995.1 658 EALNVIACEGWERVERPETYKQWHVRNLRAGFVQIPFDRELVKAAAKKVSSLYHKDFVIDEDSRWLLQGWKGRTAFALSAWK 739
                  *********************************************99999999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.512342719IPR005202Transcription factor GRAS
PfamPF035141.2E-112368739IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MDPRRRGSSD SFNGVQLGNQ PLPILSHPTV VAGSRFDSNT FLDNSYRNFS CPQPGLSANS  60
VSSYSSVSPE DDSAEDCDFS DVVLKYINQM LMEEDMEDKT CMLKESLELQ AAEKSFYEVL  120
GKKYPPSPEL FHRYASQYGE IPAESSSGTW SNYITSSCNS GGYFGDTTSI QSPDGYSSQL  180
QGLPSYRISQ SFNGYGLVDS PNSSIYSPDW NTESQSVWQF NKGVEEASRF LPGETNLVVE  240
LEANEMSVQT PKIGAAASYV KVERTDEGEY SSGGSRGKKN LYREDEDVEE KRSSKQAAFS  300
SESPLRSEMF DVVLLCSTGE GQERLESLRE ALQNGMSKSV IQNGQSEVSK GGKGRGKKQS  360
VKKEVVDLRT LLISWAQAVA ADDHRTANEL LKKVRQHSSP FGDGTQRLAH CFANGLEARL  420
AGTGSKIYKG LVSKRTSAAD ILKAYHLYLA ASPFKKMSNF VSNVTIMNLA EKSTRLHVID  480
FGILYGFQWP TLIQRISWRE GGPPKVRITG IEFPQPGFRP AERVEETGRR LAAYAEKFNV  540
PFEYNAIAKK WETITLEELK IDKDEVLVVN FLYRGKNLLD ESVSVDSVRN RVLDLIRRIN  600
PDIFIHGVVN GAYNAPFFVT RFREALFHFS SLFDMLETVV PREDQERMLI EKEIFGREAL  660
NVIACEGWER VERPETYKQW HVRNLRAGFV QIPFDRELVK AAAKKVSSLY HKDFVIDEDS  720
RWLLQGWKGR TAFALSAWKP A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-433727398375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345401.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM5W3W50.0M5W3W5_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein